KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTS QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTKQESKPVQMMCMNNSFNVATLPAE >P01013 GENE X PROTEIN (OVALBUMIN-RELATED) Lines of text be shorter than 80 characters in length. The description line (defline) is distinguished from the sequenceĭata by a greater-than (">") symbol at the beginning. Ī sequence in FASTA format begins with a single-line description, followed by lines Accepted input types are FASTA, bare sequence, or sequence identifiers. To allow this feature there are certain conventions required with regard to the input of identifiers The query sequence(s) to be used for a BLAST search should be pasted in the 'Search' text area.īLAST accepts a number of different types of input and automatically determines the format or the input.
0 Comments
Leave a Reply. |
AuthorWrite something about yourself. No need to be fancy, just an overview. ArchivesCategories |